CDS

Accession Number TCMCG065C35812
gbkey CDS
Protein Id YP_008815779.1
Location 70217..70438
Gene psbH
GeneID 19526817
Organism Setaria italica
locus_tag W841_p035

Protein

Length 73aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA228997
db_source NC_022850.1
Definition photosystem II phosphoprotein (plastid) [Setaria italica]
Locus_tag W841_p035

EGGNOG-MAPPER Annotation

COG_category S
Description One of the components of the core complex of photosystem II (PSII), required for its stability and or assembly. PSII is a light-driven water plastoquinone oxidoreductase that uses light energy to abstract electrons from H(2)O, generating O(2) and a proton gradient subsequently used for ATP formation. It consists of a core antenna complex that captures photons, and an electron transfer chain that converts photonic excitation into a charge separation
KEGG_TC -
KEGG_Module -
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko00194        [VIEW IN KEGG]
KEGG_ko ko:K02709        [VIEW IN KEGG]
EC -
KEGG_Pathway ko00195        [VIEW IN KEGG]
ko01100        [VIEW IN KEGG]
map00195        [VIEW IN KEGG]
map01100        [VIEW IN KEGG]
GOs GO:0005575        [VIEW IN EMBL-EBI]
GO:0005622        [VIEW IN EMBL-EBI]
GO:0005623        [VIEW IN EMBL-EBI]
GO:0005737        [VIEW IN EMBL-EBI]
GO:0009507        [VIEW IN EMBL-EBI]
GO:0009521        [VIEW IN EMBL-EBI]
GO:0009523        [VIEW IN EMBL-EBI]
GO:0009534        [VIEW IN EMBL-EBI]
GO:0009535        [VIEW IN EMBL-EBI]
GO:0009536        [VIEW IN EMBL-EBI]
GO:0009579        [VIEW IN EMBL-EBI]
GO:0009654        [VIEW IN EMBL-EBI]
GO:0016020        [VIEW IN EMBL-EBI]
GO:0031976        [VIEW IN EMBL-EBI]
GO:0031984        [VIEW IN EMBL-EBI]
GO:0032991        [VIEW IN EMBL-EBI]
GO:0034357        [VIEW IN EMBL-EBI]
GO:0042651        [VIEW IN EMBL-EBI]
GO:0043226        [VIEW IN EMBL-EBI]
GO:0043227        [VIEW IN EMBL-EBI]
GO:0043229        [VIEW IN EMBL-EBI]
GO:0043231        [VIEW IN EMBL-EBI]
GO:0044422        [VIEW IN EMBL-EBI]
GO:0044424        [VIEW IN EMBL-EBI]
GO:0044425        [VIEW IN EMBL-EBI]
GO:0044434        [VIEW IN EMBL-EBI]
GO:0044435        [VIEW IN EMBL-EBI]
GO:0044436        [VIEW IN EMBL-EBI]
GO:0044444        [VIEW IN EMBL-EBI]
GO:0044446        [VIEW IN EMBL-EBI]
GO:0044464        [VIEW IN EMBL-EBI]
GO:0055035        [VIEW IN EMBL-EBI]
GO:0098796        [VIEW IN EMBL-EBI]
GO:1902494        [VIEW IN EMBL-EBI]
GO:1990204        [VIEW IN EMBL-EBI]

Sequence

CDS:  
ATGGCTACACAAACCGTTGAAGATAGTTCTAGACCTAAGCCAAAACGGACTGGCGCAGGTAGTTTATTAAAACCCTTGAATTCGGAATATGGGAAAGTAGCTCCGGGTTGGGGGACTACTCCTTTTATGGGGGTCGCAATGGCTTTATTCGCGATATTCCTATCTATCATTTTAGAAATTTATAATTCTTCTGTTTTACTGGACGGAATTTTAACGAATTAG
Protein:  
MATQTVEDSSRPKPKRTGAGSLLKPLNSEYGKVAPGWGTTPFMGVAMALFAIFLSIILEIYNSSVLLDGILTN